PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_050990_kqjn.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 173aa    MW: 19532.9 Da    PI: 6.5324
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_050990_kqjn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.16.8e-123391563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+ +NRe+ArrsR RK++ ++ L   v +  + N++L + ++  ++++ k ++e+
  Bv3_050990_kqjn.t1 33 RKRKRMLSNRESARRSRMRKQKHLDDLMVQVSNVRKTNHQLLNSINITSQQYVKIEAEN 91
                        57899****************************************99999998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.4E-162993IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-103083No hitNo description
PROSITE profilePS5021710.143194IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-123385No hitNo description
PfamPF001703.5E-93390IPR004827Basic-leucine zipper domain
CDDcd147021.38E-193484No hitNo description
PROSITE patternPS0003603651IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MASPGGVTSS GTSSLQQNSS SEEEMQMQIM DERKRKRMLS NRESARRSRM RKQKHLDDLM  60
VQVSNVRKTN HQLLNSINIT SQQYVKIEAE NSVLRAQMSE LSSRLQSLNE IINALNSCTN  120
NQTMGVYGGD DQGEGLFPII PEPFTSDSFM INPWDSATYV NQPIMASANM FQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13253RKRKRMLSNRESARRSRMRKQK
24552RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671337.11e-126PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0J8FKP21e-126A0A0J8FKP2_BETVU; Uncharacterized protein
STRINGPOPTR_0004s16560.19e-56(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.11e-42basic leucine-zipper 2